DHODH antibody

Name DHODH antibody
Supplier Fitzgerald
Catalog 70R-6495
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Dog
Antigen DHODH antibody was raised using the N terminal of DHODH corresponding to a region with amino acids GEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNS
Purity/Format Affinity purified
Blocking Peptide DHODH Blocking Peptide
Description Rabbit polyclonal DHODH antibody raised against the N terminal of DHODH
Gene DHODH
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.