| Name | LIAS antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2254 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | LIAS antibody was raised using the N terminal of LIAS corresponding to a region with amino acids LLQNGPDLQDFVSGDLADRSTWDEYKGNLKRQKGERLRLPPWLKTEIPMG |
| Purity/Format | Affinity purified |
| Blocking Peptide | LIAS Blocking Peptide |
| Description | Rabbit polyclonal LIAS antibody raised against the N terminal of LIAS |
| Gene | LIAS |
| Supplier Page | Shop |