Name | C17orf75 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-4017 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | C17orf75 antibody was raised using the middle region of C17orf75 corresponding to a region with amino acids KLKAIQDTNNLKRFIRQAEMNHYALFKCYMFLKNCGSGDILLKIVKVEHE |
Purity/Format | Affinity purified |
Blocking Peptide | C17orf75 Blocking Peptide |
Description | Rabbit polyclonal C17orf75 antibody raised against the middle region of C17orf75 |
Gene | C17orf75 |
Supplier Page | Shop |