| Name | IPP antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4396 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | IPP antibody was raised using the C terminal of IPP corresponding to a region with amino acids EMQGLIYVIGGISNEGIELRSFEVYDPLSKRWSPLPPMGTRRAYLGVAAL |
| Purity/Format | Affinity purified |
| Blocking Peptide | IPP Blocking Peptide |
| Description | Rabbit polyclonal IPP antibody raised against the C terminal of IPP |
| Gene | IPP |
| Supplier Page | Shop |