Name | IPP antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-4396 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat |
Antigen | IPP antibody was raised using the C terminal of IPP corresponding to a region with amino acids EMQGLIYVIGGISNEGIELRSFEVYDPLSKRWSPLPPMGTRRAYLGVAAL |
Purity/Format | Affinity purified |
Blocking Peptide | IPP Blocking Peptide |
Description | Rabbit polyclonal IPP antibody raised against the C terminal of IPP |
Gene | IPP |
Supplier Page | Shop |