C18ORF10 antibody

Name C18ORF10 antibody
Supplier Fitzgerald
Catalog 70R-3403
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse
Antigen C18ORF10 antibody was raised using the middle region of C18Orf10 corresponding to a region with amino acids SMYSLPNAPTLADLEDDTHEASDDQPEKPHFDSRSVIFELDSCNGSGKVC
Purity/Format Affinity purified
Blocking Peptide C18ORF10 Blocking Peptide
Description Rabbit polyclonal C18ORF10 antibody raised against the middle region of C18Orf10
Gene TPGS2
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.