Name | CEP55 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-2148 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | CEP55 antibody was raised using the N terminal of CEP55 corresponding to a region with amino acids MSSRSTKDLIKSKWGSKPSNSKSETTLEKLKGEIAHLKTSVDEITSGKGK |
Purity/Format | Affinity purified |
Blocking Peptide | CEP55 Blocking Peptide |
Description | Rabbit polyclonal CEP55 antibody raised against the N terminal of CEP55 |
Gene | CEP55 |
Supplier Page | Shop |