| Name | RABGGTA antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2976 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | RABGGTA antibody was raised using the N terminal of RABGGTA corresponding to a region with amino acids ELAFTDSLITRNFSNYSSWHYRSCLLPQLHPQPDSGPQGRLPEDVLLKEL |
| Purity/Format | Affinity purified |
| Blocking Peptide | RABGGTA Blocking Peptide |
| Description | Rabbit polyclonal RABGGTA antibody raised against the N terminal of RABGGTA |
| Gene | RABGGTA |
| Supplier Page | Shop |