Name | ACCN4 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-5090 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Dog |
Antigen | ACCN4 antibody was raised using the N terminal of ACCN4 corresponding to a region with amino acids SPSSRGQMPIEIVCKIKFAEEDAKPKEKEAGDEQSLLGAVAPGAAPRDLA |
Purity/Format | Affinity purified |
Blocking Peptide | ACCN4 Blocking Peptide |
Description | Rabbit polyclonal ACCN4 antibody raised against the N terminal of ACCN4 |
Gene | ASIC4 |
Supplier Page | Shop |