CLCNKB antibody

Name CLCNKB antibody
Supplier Fitzgerald
Catalog 70R-5058
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen CLCNKB antibody was raised using the N terminal of CLCNKB corresponding to a region with amino acids MEEFVGLREGSSGNPVTLQELWGPCPRIRRGIRGGLEWLKQKLFRLGEDW
Purity/Format Affinity purified
Blocking Peptide CLCNKB Blocking Peptide
Description Rabbit polyclonal CLCNKB antibody raised against the N terminal of CLCNKB
Gene CLCNKB
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.