| Name | WNT16 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1909 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | WNT16 antibody was raised using the C terminal of WNT16 corresponding to a region with amino acids REKDQRKIPIHKDDLLYVNKSPNYCVEDKKLGIPGTQGRECNRTSEGADG |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | WNT16 Blocking Peptide |
| Description | Rabbit polyclonal WNT16 antibody raised against the C terminal of WNT16 |
| Gene | WNT16 |
| Supplier Page | Shop |