| Name | BAT5 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6310 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | BAT5 antibody was raised using the middle region of BAT5 corresponding to a region with amino acids RAKLLACDGNEIDTMFVDRRGTAEPQGQKLVICCEGNAGFYEVGCVSTPL |
| Purity/Format | Affinity purified |
| Blocking Peptide | BAT5 Blocking Peptide |
| Description | Rabbit polyclonal BAT5 antibody raised against the middle region of BAT5 |
| Gene | ABHD16A |
| Supplier Page | Shop |