KCNJ1 antibody

Name KCNJ1 antibody
Supplier Fitzgerald
Catalog 70R-5144
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen KCNJ1 antibody was raised using the middle region of KCNJ1 corresponding to a region with amino acids LRKSLLIGSHIYGKLLKTTVTPEGETIILDQININFVVDAGNENLFFISP
Purity/Format Affinity purified
Blocking Peptide KCNJ1 Blocking Peptide
Description Rabbit polyclonal KCNJ1 antibody raised against the middle region of KCNJ1
Gene KCNJ1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.