MTHFD1 antibody

Name MTHFD1 antibody
Supplier Fitzgerald
Catalog 70R-2357
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen MTHFD1 antibody was raised using a synthetic peptide corresponding to a region with amino acids RTTTESEVMKYITSLNEDSTVHGFLVQLPLDSENSINTEEVINAIAPEKD
Purity/Format Affinity purified
Blocking Peptide MTHFD1 Blocking Peptide
Description Rabbit polyclonal MTHFD1 antibody
Gene MTHFD1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.