SEC23B antibody

Name SEC23B antibody
Supplier Fitzgerald
Catalog 70R-3255
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen SEC23B antibody was raised using a synthetic peptide corresponding to a region with amino acids SFSLYPQFMFHLRRSPFLQVFNNSPDESSYYRHHFARQDLTQSLIMIQPI
Purity/Format Affinity purified
Blocking Peptide SEC23B Blocking Peptide
Description Rabbit polyclonal SEC23B antibody
Gene SEC23B
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.