Name | DIP2A antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-4403 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | DIP2A antibody was raised using a synthetic peptide corresponding to a region with amino acids PLKEFFVDDFEELLEVQQPDPNQPKPEGSETSVLRGEPLTAGVPRPPSLL |
Purity/Format | Affinity purified |
Blocking Peptide | DIP2A Blocking Peptide |
Description | Rabbit polyclonal DIP2A antibody |
Gene | DIP2A |
Supplier Page | Shop |