RAD54B antibody

Name RAD54B antibody
Supplier Fitzgerald
Catalog 70R-5653
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen RAD54B antibody was raised using a synthetic peptide corresponding to a region with amino acids RRSAAPSQLQGNSFKKPKFIPPGRSNPGLNEEITKLNPDIKLFEGVAINN
Purity/Format Affinity purified
Blocking Peptide RAD54B Blocking Peptide
Description Rabbit polyclonal RAD54B antibody
Gene FSBP
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.