| Name | GSR antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5268 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | GSR antibody was raised using the N terminal of GSR corresponding to a region with amino acids PTIEVSGKKYTAPHILIATGGMPSTPHESQIPGASLGITSDGFFQLEELP |
| Purity/Format | Affinity purified |
| Blocking Peptide | GSR Blocking Peptide |
| Description | Rabbit polyclonal GSR antibody raised against the N terminal of GSR |
| Gene | GSR |
| Supplier Page | Shop |