Name | PLA2G4E antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-4051 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | PLA2G4E antibody was raised using the C terminal of PLA2G4E corresponding to a region with amino acids TFFPLINDTFRKYKAPGVERSPEELEQGQVDIYGPKTPYATKELTYTEAT |
Purity/Format | Affinity purified |
Blocking Peptide | PLA2G4E Blocking Peptide |
Description | Rabbit polyclonal PLA2G4E antibody raised against the c terminal of PLA2G4E |
Gene | PLA2G4E |
Supplier Page | Shop |