| Name | PLA2G4E antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4051 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | PLA2G4E antibody was raised using the C terminal of PLA2G4E corresponding to a region with amino acids TFFPLINDTFRKYKAPGVERSPEELEQGQVDIYGPKTPYATKELTYTEAT |
| Purity/Format | Affinity purified |
| Blocking Peptide | PLA2G4E Blocking Peptide |
| Description | Rabbit polyclonal PLA2G4E antibody raised against the c terminal of PLA2G4E |
| Gene | PLA2G4E |
| Supplier Page | Shop |