SI antibody

Name SI antibody
Supplier Fitzgerald
Catalog 70R-7230
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen SI antibody was raised using a synthetic peptide corresponding to a region with amino acids LPCQEPAQNTFYSRQKHMKLIVAADDNQMAQGSLFWDDGESIDTYERDLY
Purity/Format Affinity purified
Blocking Peptide SI Blocking Peptide
Description Rabbit polyclonal SI antibody
Gene SI
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.