Name | RHOA antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-5840 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Dog |
Antigen | RHOA antibody was raised using the middle region of RHOA corresponding to a region with amino acids GRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLVL |
Purity/Format | Affinity purified |
Blocking Peptide | RHOA Blocking Peptide |
Description | Rabbit polyclonal RHOA antibody raised against the middle region of RHOA |
Gene | RHOA |
Supplier Page | Shop |