| Name | RHOA antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5840 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Dog |
| Antigen | RHOA antibody was raised using the middle region of RHOA corresponding to a region with amino acids GRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLVL |
| Purity/Format | Affinity purified |
| Blocking Peptide | RHOA Blocking Peptide |
| Description | Rabbit polyclonal RHOA antibody raised against the middle region of RHOA |
| Gene | RHOA |
| Supplier Page | Shop |