| Name | C4BPA antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5739 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | C4BPA antibody was raised using the middle region of C4BPA corresponding to a region with amino acids QVLTGKRLMQCLPNPEDVKMALEVYKLSLEIEQLELQRDSARQSTLDKEL |
| Purity/Format | Affinity purified |
| Blocking Peptide | C4BPA Blocking Peptide |
| Description | Rabbit polyclonal C4BPA antibody raised against the middle region of C4BPA |
| Gene | C4BPB |
| Supplier Page | Shop |