EIF2S2 antibody

Name EIF2S2 antibody
Supplier Fitzgerald
Catalog 70R-4905
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen EIF2S2 antibody was raised using the N terminal of EIF2S2 corresponding to a region with amino acids TQTEETQPSETKEVEPEPTEDKDLEADEEDTRKKDASDDLDDLNFFNQKK
Purity/Format Affinity purified
Blocking Peptide EIF2S2 Blocking Peptide
Description Rabbit polyclonal EIF2S2 antibody raised against the N terminal of EIF2S2
Gene EIF2S1
Supplier Page Shop