SC4MOL antibody

Name SC4MOL antibody
Supplier Fitzgerald
Catalog 70R-1734
Prices $275.00
Sizes 100 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse
Antigen SC4MOL antibody was raised using the N terminal of SC4MOL corresponding to a region with amino acids MATNESVSIFSSASLAVEYVDSLLPENPLQEPFKNAWNYMLNNYTKFQIA
Purity/Format Total IgG Protein A purified
Blocking Peptide SC4MOL Blocking Peptide
Description Rabbit polyclonal SC4MOL antibody raised against the N terminal of SC4MOL
Gene MSMO1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.