Synaptogyrin 2 antibody

Name Synaptogyrin 2 antibody
Supplier Fitzgerald
Catalog 70R-6322
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synaptogyrin 2 antibody was raised using the N terminal of SYNGR2 corresponding to a region with amino acids ESGAYGAAKAGGSFDLRRFLTQPQVVARAVCLVFALIVFSCIYGEGYSNA
Purity/Format Affinity purified
Blocking Peptide Synaptogyrin 2 Blocking Peptide
Description Rabbit polyclonal Synaptogyrin 2 antibody raised against the N terminal of SYNGR2
Gene SYNGR2
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.