Name | PLSCR1 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-4068 |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | PLSCR1 antibody was raised using the N terminal of PLSCR1 corresponding to a region with amino acids MDKQNSQMNASHPETNLPVGYPPQYPPTAFQGPPGYSGYPGPQVSYPPPP |
Purity/Format | Affinity purified |
Blocking Peptide | PLSCR1 Blocking Peptide |
Description | Rabbit polyclonal PLSCR1 antibody raised against the N terminal of PLSCR1 |
Gene | PLSCR1 |
Supplier Page | Shop |