| Name | CNP antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1054 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | CNP antibody was raised using the N terminal of CNP corresponding to a region with amino acids YKITPGARGAFSEEYKRLDEDLAAYCRRRDIRILVLDDTNHERERLEQLF |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | CNP Blocking Peptide |
| Description | Rabbit polyclonal CNP antibody raised against the N terminal of CNP |
| Gene | CNP |
| Supplier Page | Shop |