| Name | EIF3S9 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4767 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | EIF3S9 antibody was raised using the C terminal of EIF3S9 corresponding to a region with amino acids YRKMAQELYMEQKNERLELRGGVDTDELDSNVDDWEEETIEFFVTEEIIP |
| Purity/Format | Affinity purified |
| Blocking Peptide | EIF3S9 Blocking Peptide |
| Description | Rabbit polyclonal EIF3S9 antibody raised against the C terminal of EIF3S9 |
| Gene | EIF3B |
| Supplier Page | Shop |