Name | EIF3S9 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-4767 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat |
Antigen | EIF3S9 antibody was raised using the C terminal of EIF3S9 corresponding to a region with amino acids YRKMAQELYMEQKNERLELRGGVDTDELDSNVDDWEEETIEFFVTEEIIP |
Purity/Format | Affinity purified |
Blocking Peptide | EIF3S9 Blocking Peptide |
Description | Rabbit polyclonal EIF3S9 antibody raised against the C terminal of EIF3S9 |
Gene | EIF3B |
Supplier Page | Shop |