KYNU antibody

Name KYNU antibody
Supplier Fitzgerald
Catalog 70R-3487
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications IHC WB
Species Reactivities Human
Antigen KYNU antibody was raised using a synthetic peptide corresponding to a region with amino acids LAHAVGNVELYLHDWGVDFACWCSYKYLNAGAGGIAGAFIHEKHAHTIKP
Purity/Format Affinity purified
Blocking Peptide KYNU Blocking Peptide
Description Rabbit polyclonal KYNU antibody
Gene KYNU
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.