Name | FTCD antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-1140 |
Prices | $275.00 |
Sizes | 100 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | IHC WB |
Species Reactivities | Human, Mouse, Rat, Dog |
Antigen | FTCD antibody was raised using the N terminal of FTCD corresponding to a region with amino acids FSEGKNQEVIDAISGAITQTPGCVLLDVDAGPSTNRTVYTFVGPPECVVE |
Purity/Format | Total IgG Protein A purified |
Blocking Peptide | FTCD Blocking Peptide |
Description | Rabbit polyclonal FTCD antibody raised against the N terminal of FTCD |
Gene | FTCD |
Supplier Page | Shop |