KLHL23 antibody

Name KLHL23 antibody
Supplier Fitzgerald
Catalog 70R-4922
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen KLHL23 antibody was raised using a synthetic peptide corresponding to a region with amino acids TYDKVQSYNSDINEWSLITSSPHPEYGLCSVPFENKLYLVGGQTTITECY
Purity/Format Affinity purified
Blocking Peptide KLHL23 Blocking Peptide
Description Rabbit polyclonal KLHL23 antibody
Gene PHOSPHO2
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.