Name | IFIT5 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-5820 |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | IFIT5 antibody was raised using the middle region of IFIT5 corresponding to a region with amino acids ITVYRLDDSDREGSVKSFSLGPLRKAVTLNPDNSYIKVFLALKLQDVHAE |
Purity/Format | Affinity purified |
Blocking Peptide | IFIT5 Blocking Peptide |
Description | Rabbit polyclonal IFIT5 antibody raised against the middle region of IFIT5 |
Gene | IFIT5 |
Supplier Page | Shop |