OTUB1 antibody

Name OTUB1 antibody
Supplier Fitzgerald
Catalog 70R-3802
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen OTUB1 antibody was raised using the N terminal of OTUB1 corresponding to a region with amino acids DRIQQEIAVQNPLVSERLELSVLYKEYAEDDNIYQQKIKDLHKKYSYIRK
Purity/Format Affinity purified
Blocking Peptide OTUB1 Blocking Peptide
Description Rabbit polyclonal OTUB1 antibody raised against the N terminal of OTUB1
Gene OTUB1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.