CLN8 antibody

Name CLN8 antibody
Supplier Fitzgerald
Catalog 70R-7114
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Dog
Antigen CLN8 antibody was raised using a synthetic peptide corresponding to a region with amino acids MNPASDGGTSESIFDLDYASWGIRSTLMVAGFVFYLGVFVVCHQLSSSLN
Purity/Format Affinity purified
Blocking Peptide CLN8 Blocking Peptide
Description Rabbit polyclonal CLN8 antibody
Gene CLN8
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.