| Name | HSPB8 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2327 |
| Prices | $375.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | HSPB8 antibody was raised using the middle region of HSPB8 corresponding to a region with amino acids PEELMVKTKDGYVEVSGKHEEKQQEGGIVSKNFTKKIQLPAEVDPVTVFA |
| Purity/Format | Affinity purified |
| Blocking Peptide | HSPB8 Blocking Peptide |
| Description | Rabbit polyclonal HSPB8 antibody raised against the middle region of HSPB8 |
| Gene | HSPB8 |
| Supplier Page | Shop |