NEURL antibody

Name NEURL antibody
Supplier Fitzgerald
Catalog 70R-5243
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen NEURL antibody was raised using a synthetic peptide corresponding to a region with amino acids RLKITKKQCCWSGALRLGFTSKDPSRIHPDSLPKYACPDLVSQSGFWAKA
Purity/Format Affinity purified
Blocking Peptide NEURL Blocking Peptide
Description Rabbit polyclonal NEURL antibody
Gene NEURL1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.