Name | BXDC2 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-3417 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | BXDC2 antibody was raised using the middle region of Bxdc2 corresponding to a region with amino acids ALLKELLIQIFSTPRYHPKSQPFVDHVFTFTILDNRIWFRNFQIIEEDAA |
Purity/Format | Affinity purified |
Blocking Peptide | BXDC2 Blocking Peptide |
Description | Rabbit polyclonal BXDC2 antibody raised against the middle region of Bxdc2 |
Gene | BRIX1 |
Supplier Page | Shop |