| Name | Decorin antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5367 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Dog |
| Antigen | Decorin antibody was raised using the N terminal of DCN corresponding to a region with amino acids IGPEVPDDRDFEPSLGPVCPFRCQCHLRVVQCSDLGLDKVPKDLPPDTTL |
| Purity/Format | Affinity purified |
| Blocking Peptide | Decorin Blocking Peptide |
| Description | Rabbit polyclonal Decorin antibody raised against the N terminal of DCN |
| Gene | TPGS2 |
| Supplier Page | Shop |