| Name | NT5C1B antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4405 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | NT5C1B antibody was raised using the N terminal of NT5C1B corresponding to a region with amino acids MSQTSLKQKKNEPGMRSSKESLEAEKRKESDKTGVRLSNQGSQESSLRKT |
| Purity/Format | Affinity purified |
| Blocking Peptide | NT5C1B Blocking Peptide |
| Description | Rabbit polyclonal NT5C1B antibody raised against the N terminal of NT5C1B |
| Gene | NT5C1B |
| Supplier Page | Shop |