| Name | C9ORF68 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4309 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | C9ORF68 antibody was raised using the middle region of C9Orf68 corresponding to a region with amino acids CLDSSQFGKSSSSKQGDADFHGKASFATYQHSTSPGPLDQPLLRERFHPG |
| Purity/Format | Affinity purified |
| Blocking Peptide | C9ORF68 Blocking Peptide |
| Description | Rabbit polyclonal C9ORF68 antibody raised against the middle region of C9Orf68 |
| Gene | SPATA6L |
| Supplier Page | Shop |