| Name | alpha Actinin 4 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2835 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | alpha Actinin 4 antibody was raised using the C terminal of ACTN4 corresponding to a region with amino acids DVENDRQGEAEFNRIMSLVDPNHSGLVTFQAFIDFMSRETTDTDTADQVI |
| Purity/Format | Affinity purified |
| Blocking Peptide | alpha Actinin 4 Blocking Peptide |
| Description | Rabbit polyclonal alpha Actinin 4 antibody raised against the C terminal of ACTN4 |
| Gene | ACTN4 |
| Supplier Page | Shop |