| Name | BCKDHA antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5330 |
| Prices | $375.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | BCKDHA antibody was raised using the N terminal of BCKDHA corresponding to a region with amino acids NVISGIPIYRVMDRQGQIINPSEDPHLPKEKVLKLYKSMTLLNTMDRILY |
| Purity/Format | Affinity purified |
| Blocking Peptide | BCKDHA Blocking Peptide |
| Description | Rabbit polyclonal BCKDHA antibody raised against the N terminal of BCKDHA |
| Gene | BCKDHA |
| Supplier Page | Shop |