| Name | YWHAZ antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3632 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | YWHAZ antibody was raised using the middle region of Ywhaz corresponding to a region with amino acids FDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN |
| Purity/Format | Affinity purified |
| Blocking Peptide | YWHAZ Blocking Peptide |
| Description | Rabbit polyclonal YWHAZ antibody raised against the middle region of Ywhaz |
| Gene | YWHAE |
| Supplier Page | Shop |