| Name | PSD3 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1226 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | PSD3 antibody was raised using the middle region of PSD3 corresponding to a region with amino acids SDVAKHLGKNNEFSKLVAEEYLKFFDFTGMTLDQSLRYFFKAFSLVGETQ |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | PSD3 Blocking Peptide |
| Description | Rabbit polyclonal PSD3 antibody raised against the middle region of PSD3 |
| Gene | BDH2 |
| Supplier Page | Shop |