Name | RPESP antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-3306 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat |
Antigen | RPESP antibody was raised using the C terminal of RPESP corresponding to a region with amino acids WMQYLREGYTVCVDCQPPAMNSVSLRCSGDGLDSDGNQTLHWQAIGNPRC |
Purity/Format | Affinity purified |
Blocking Peptide | RPESP Blocking Peptide |
Description | Rabbit polyclonal RPESP antibody raised against the C terminal of RPESP |
Gene | SBSPON |
Supplier Page | Shop |