Name | LRRC56 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-4203 |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse |
Antigen | LRRC56 antibody was raised using the N terminal of LRRC56 corresponding to a region with amino acids LEMCVDTREGSLGNFGVHLPNLDQLKLNGSHLGSLRDLGTSLGHLQVLWL |
Purity/Format | Affinity purified |
Blocking Peptide | LRRC56 Blocking Peptide |
Description | Rabbit polyclonal LRRC56 antibody raised against the N terminal of LRRC56 |
Gene | LRRC56 |
Supplier Page | Shop |