| Name | DGAT2L4 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6970 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | DGAT2L4 antibody was raised using the C terminal of DGAT2L4 corresponding to a region with amino acids GEPLPMPKIENPSQEIVAKYHTLYIDALRKLFDQHKTKFGISETQELEII |
| Purity/Format | Affinity purified |
| Blocking Peptide | DGAT2L4 Blocking Peptide |
| Description | Rabbit polyclonal DGAT2L4 antibody raised against the C terminal of DGAT2L4 |
| Gene | DGAT2 |
| Supplier Page | Shop |