| Name | RPSA antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6040 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | RPSA antibody was raised using the middle region of RPSA corresponding to a region with amino acids TFTNQIQAAFREPRLLVVTDPRADHQPLTEASYVNLPTIALCNTDSPLRY |
| Purity/Format | Affinity purified |
| Blocking Peptide | RPSA Blocking Peptide |
| Description | Rabbit polyclonal RPSA antibody raised against the middle region of RPSA |
| Gene | RPSA |
| Supplier Page | Shop |