| Name | B3GALT6 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-7452 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | B3GALT6 antibody was raised using the N terminal of B3GALT6 corresponding to a region with amino acids EREQARHGDLLLLPALRDAYENLTAKVLAMLAWLDEHVAFEFVLKADDDS |
| Purity/Format | Affinity purified |
| Blocking Peptide | B3GALT6 Blocking Peptide |
| Description | Rabbit polyclonal B3GALT6 antibody raised against the N terminal of B3GALT6 |
| Gene | B3GALT6 |
| Supplier Page | Shop |