| Name | ODF2L antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4299 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Rat |
| Antigen | ODF2L antibody was raised using the N terminal of ODF2L corresponding to a region with amino acids KTVALKKASKVYKQRLDHFTGAIEKLTSQIRDQEAKLSETISASNAWKSH |
| Purity/Format | Affinity purified |
| Blocking Peptide | ODF2L Blocking Peptide |
| Description | Rabbit polyclonal ODF2L antibody raised against the N terminal of ODF2L |
| Gene | ODF2L |
| Supplier Page | Shop |