Name | BLNK antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-5736 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat |
Antigen | BLNK antibody was raised using the middle region of BLNK corresponding to a region with amino acids QYALGRKKNGEEYFGSVAEIIRNHQHSPLVLIDSQNNTKDSTRLKYAVKV |
Purity/Format | Affinity purified |
Blocking Peptide | BLNK Blocking Peptide |
Description | Rabbit polyclonal BLNK antibody raised against the middle region of BLNK |
Gene | BLNK |
Supplier Page | Shop |